Anti ADH6 pAb (ATL-HPA069081 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069081-25

• 
• 

Protein Description: alcohol dehydrogenase 6 (class V)
Gene Name: ADH6
Alternative Gene Name: ADH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074207: 61%, ENSRNOG00000012436: 67%
Entrez Gene ID: 130
Uniprot ID: P28332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW
• Gene Sequence: VADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW
• Gene ID - Mouse: ENSMUSG00000074207
• Gene ID - Rat: ENSRNOG00000012436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.