Anti ADH5 pAb (ATL-HPA061919 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061919-100

• 
• 

Protein Description: alcohol dehydrogenase 5 (class III), chi polypeptide
Gene Name: ADH5
Alternative Gene Name: ADH-3, ADHX, FDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028138: 90%, ENSRNOG00000046357: 92%
Entrez Gene ID: 128
Uniprot ID: P11766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI
• Gene Sequence: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI
• Gene ID - Mouse: ENSMUSG00000028138
• Gene ID - Rat: ENSRNOG00000046357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.