Anti ADH5 pAb (ATL-HPA044578)

Atlas Antibodies

Catalog No.:
ATL-HPA044578-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: alcohol dehydrogenase 5 (class III), chi polypeptide
Gene Name: ADH5
Alternative Gene Name: ADH-3, ADHX, FDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028138: 95%, ENSRNOG00000046357: 93%
Entrez Gene ID: 128
Uniprot ID: P11766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
Gene Sequence DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
Gene ID - Mouse ENSMUSG00000028138
Gene ID - Rat ENSRNOG00000046357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADH5 pAb (ATL-HPA044578)
Datasheet Anti ADH5 pAb (ATL-HPA044578) Datasheet (External Link)
Vendor Page Anti ADH5 pAb (ATL-HPA044578) at Atlas Antibodies

Documents & Links for Anti ADH5 pAb (ATL-HPA044578)
Datasheet Anti ADH5 pAb (ATL-HPA044578) Datasheet (External Link)
Vendor Page Anti ADH5 pAb (ATL-HPA044578)