Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA020525-25
  • Immunohistochemistry analysis in human liver and tonsil tissues using HPA020525 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alcohol dehydrogenase 4 (class II), pi polypeptide
Gene Name: ADH4
Alternative Gene Name: ADH-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037797: 66%, ENSRNOG00000046357: 66%
Entrez Gene ID: 127
Uniprot ID: P08319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
Gene Sequence ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
Gene ID - Mouse ENSMUSG00000037797
Gene ID - Rat ENSRNOG00000046357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation)
Datasheet Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation)
Datasheet Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation)



Citations for Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) – 2 Found
Xiao, Yangyan; de Paiva, Cintia S; Yu, Zhiyuan; de Souza, Rodrigo G; Li, De-Quan; Pflugfelder, Stephen C. Goblet cell-produced retinoic acid suppresses CD86 expression and IL-12 production in bone marrow-derived cells. International Immunology. 2018;30(10):457-470.  PubMed
Fagerberg, Linn; Hallström, Björn M; Oksvold, Per; Kampf, Caroline; Djureinovic, Dijana; Odeberg, Jacob; Habuka, Masato; Tahmasebpoor, Simin; Danielsson, Angelika; Edlund, Karolina; Asplund, Anna; Sjöstedt, Evelina; Lundberg, Emma; Szigyarto, Cristina Al-Khalili; Skogs, Marie; Takanen, Jenny Ottosson; Berling, Holger; Tegel, Hanna; Mulder, Jan; Nilsson, Peter; Schwenk, Jochen M; Lindskog, Cecilia; Danielsson, Frida; Mardinoglu, Adil; Sivertsson, Asa; von Feilitzen, Kalle; Forsberg, Mattias; Zwahlen, Martin; Olsson, IngMarie; Navani, Sanjay; Huss, Mikael; Nielsen, Jens; Ponten, Fredrik; Uhlén, Mathias. Analysis of the human tissue-specific expression by genome-wide integration of transcriptomics and antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2014;13(2):397-406.  PubMed