Anti ADGRL1 pAb (ATL-HPA037974)

Atlas Antibodies

Catalog No.:
ATL-HPA037974-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: adhesion G protein-coupled receptor L1
Gene Name: ADGRL1
Alternative Gene Name: CIRL1, KIAA0821, LEC2, LPHN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013033: 100%, ENSRNOG00000029134: 100%
Entrez Gene ID: 22859
Uniprot ID: O94910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
Gene Sequence GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
Gene ID - Mouse ENSMUSG00000013033
Gene ID - Rat ENSRNOG00000029134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADGRL1 pAb (ATL-HPA037974)
Datasheet Anti ADGRL1 pAb (ATL-HPA037974) Datasheet (External Link)
Vendor Page Anti ADGRL1 pAb (ATL-HPA037974) at Atlas Antibodies

Documents & Links for Anti ADGRL1 pAb (ATL-HPA037974)
Datasheet Anti ADGRL1 pAb (ATL-HPA037974) Datasheet (External Link)
Vendor Page Anti ADGRL1 pAb (ATL-HPA037974)