Anti ADGRL1 pAb (ATL-HPA037974)

Atlas Antibodies

SKU: ATL-HPA037974-25

• 

Protein Description: adhesion G protein-coupled receptor L1
Gene Name: ADGRL1
Alternative Gene Name: CIRL1, KIAA0821, LEC2, LPHN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013033: 100%, ENSRNOG00000029134: 100%
Entrez Gene ID: 22859
Uniprot ID: O94910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
• Gene Sequence: GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
• Gene ID - Mouse: ENSMUSG00000013033
• Gene ID - Rat: ENSRNOG00000029134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.