Anti ADGRF2 pAb (ATL-HPA035507)

Atlas Antibodies

SKU: ATL-HPA035507-25

• 

Protein Description: adhesion G protein-coupled receptor F2
Gene Name: ADGRF2
Alternative Gene Name: GPR111, hGPCR35, PGR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057899: 49%, ENSRNOG00000025603: 38%
Entrez Gene ID: 222611
Uniprot ID: Q8IZF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CDGVCTDYSQCTQPCPPDTQGNMGFSCRQKTWHKITDTCRTLNALNIFEEDSRLVQPFEDNIKISVYTGKSETITDMLLQKCPTD
• Gene Sequence: CDGVCTDYSQCTQPCPPDTQGNMGFSCRQKTWHKITDTCRTLNALNIFEEDSRLVQPFEDNIKISVYTGKSETITDMLLQKCPTD
• Gene ID - Mouse: ENSMUSG00000057899
• Gene ID - Rat: ENSRNOG00000025603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.