Anti ADGRF2 pAb (ATL-HPA035507)

Atlas Antibodies

SKU:
ATL-HPA035507-25
  • Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adhesion G protein-coupled receptor F2
Gene Name: ADGRF2
Alternative Gene Name: GPR111, hGPCR35, PGR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057899: 49%, ENSRNOG00000025603: 38%
Entrez Gene ID: 222611
Uniprot ID: Q8IZF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CDGVCTDYSQCTQPCPPDTQGNMGFSCRQKTWHKITDTCRTLNALNIFEEDSRLVQPFEDNIKISVYTGKSETITDMLLQKCPTD
Gene Sequence CDGVCTDYSQCTQPCPPDTQGNMGFSCRQKTWHKITDTCRTLNALNIFEEDSRLVQPFEDNIKISVYTGKSETITDMLLQKCPTD
Gene ID - Mouse ENSMUSG00000057899
Gene ID - Rat ENSRNOG00000025603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADGRF2 pAb (ATL-HPA035507)
Datasheet Anti ADGRF2 pAb (ATL-HPA035507) Datasheet (External Link)
Vendor Page Anti ADGRF2 pAb (ATL-HPA035507) at Atlas Antibodies

Documents & Links for Anti ADGRF2 pAb (ATL-HPA035507)
Datasheet Anti ADGRF2 pAb (ATL-HPA035507) Datasheet (External Link)
Vendor Page Anti ADGRF2 pAb (ATL-HPA035507)