Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013707-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ADGRE5
Alternative Gene Name: CD97, TM7LN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002885: 49%, ENSRNOG00000004489: 51%
Entrez Gene ID: 976
Uniprot ID: P48960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ |
| Gene Sequence | RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ |
| Gene ID - Mouse | ENSMUSG00000002885 |
| Gene ID - Rat | ENSRNOG00000004489 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) | |
| Datasheet | Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) | |
| Datasheet | Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) |
| Citations for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) – 2 Found |
| Hilbig, Doris; Dietrich, Norman; Wandel, Elke; Gonsior, Susann; Sittig, Doreen; Hamann, Jörg; Aust, Gabriela. The Interaction of CD97/ADGRE5 With β-Catenin in Adherens Junctions Is Lost During Colorectal Carcinogenesis. Frontiers In Oncology. 8( 29888202):182. PubMed |
| Zyryanova, Tatiana; Schneider, Rick; Adams, Volker; Sittig, Doreen; Kerner, Christiane; Gebhardt, Claudia; Ruffert, Henrik; Glasmacher, Stefan; Hepp, Pierre; Punkt, Karla; Neuhaus, Jochen; Hamann, Jörg; Aust, Gabriela. Skeletal muscle expression of the adhesion-GPCR CD97: CD97 deletion induces an abnormal structure of the sarcoplasmatic reticulum but does not impair skeletal muscle function. Plos One. 9(6):e100513. PubMed |