Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA013707-25

• 

Protein Description: adhesion G protein-coupled receptor E5
Gene Name: ADGRE5
Alternative Gene Name: CD97, TM7LN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002885: 49%, ENSRNOG00000004489: 51%
Entrez Gene ID: 976
Uniprot ID: P48960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
• Gene Sequence: RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
• Gene ID - Mouse: ENSMUSG00000002885
• Gene ID - Rat: ENSRNOG00000004489
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) – 2 Found

Hilbig, Doris; Dietrich, Norman; Wandel, Elke; Gonsior, Susann; Sittig, Doreen; Hamann, Jörg; Aust, Gabriela. The Interaction of CD97/ADGRE5 With β-Catenin in Adherens Junctions Is Lost During Colorectal Carcinogenesis. Frontiers In Oncology. 8( 29888202):182. 

Zyryanova, Tatiana; Schneider, Rick; Adams, Volker; Sittig, Doreen; Kerner, Christiane; Gebhardt, Claudia; Ruffert, Henrik; Glasmacher, Stefan; Hepp, Pierre; Punkt, Karla; Neuhaus, Jochen; Hamann, Jörg; Aust, Gabriela. Skeletal muscle expression of the adhesion-GPCR CD97: CD97 deletion induces an abnormal structure of the sarcoplasmatic reticulum but does not impair skeletal muscle function. Plos One. 9(6):e100513.