Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA013707-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: adhesion G protein-coupled receptor E5
Gene Name: ADGRE5
Alternative Gene Name: CD97, TM7LN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002885: 49%, ENSRNOG00000004489: 51%
Entrez Gene ID: 976
Uniprot ID: P48960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
Gene Sequence RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
Gene ID - Mouse ENSMUSG00000002885
Gene ID - Rat ENSRNOG00000004489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation)
Datasheet Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation)
Datasheet Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation)
Citations for Anti ADGRE5 pAb (ATL-HPA013707 w/enhanced validation) – 2 Found
Hilbig, Doris; Dietrich, Norman; Wandel, Elke; Gonsior, Susann; Sittig, Doreen; Hamann, Jörg; Aust, Gabriela. The Interaction of CD97/ADGRE5 With β-Catenin in Adherens Junctions Is Lost During Colorectal Carcinogenesis. Frontiers In Oncology. 8( 29888202):182.  PubMed
Zyryanova, Tatiana; Schneider, Rick; Adams, Volker; Sittig, Doreen; Kerner, Christiane; Gebhardt, Claudia; Ruffert, Henrik; Glasmacher, Stefan; Hepp, Pierre; Punkt, Karla; Neuhaus, Jochen; Hamann, Jörg; Aust, Gabriela. Skeletal muscle expression of the adhesion-GPCR CD97: CD97 deletion induces an abnormal structure of the sarcoplasmatic reticulum but does not impair skeletal muscle function. Plos One. 9(6):e100513.  PubMed