Anti ADGRE3 pAb (ATL-HPA015638)

Atlas Antibodies

SKU:
ATL-HPA015638-25
  • Immunohistochemical staining of human urinary bladder shows dot like cytoplasmic positivity in urothelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adhesion G protein-coupled receptor E3
Gene Name: ADGRE3
Alternative Gene Name: EMR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002885: 31%, ENSRNOG00000004489: 29%
Entrez Gene ID: 84658
Uniprot ID: Q9BY15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVL
Gene Sequence NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVL
Gene ID - Mouse ENSMUSG00000002885
Gene ID - Rat ENSRNOG00000004489
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADGRE3 pAb (ATL-HPA015638)
Datasheet Anti ADGRE3 pAb (ATL-HPA015638) Datasheet (External Link)
Vendor Page Anti ADGRE3 pAb (ATL-HPA015638) at Atlas Antibodies

Documents & Links for Anti ADGRE3 pAb (ATL-HPA015638)
Datasheet Anti ADGRE3 pAb (ATL-HPA015638) Datasheet (External Link)
Vendor Page Anti ADGRE3 pAb (ATL-HPA015638)