Anti ADGRB2 pAb (ATL-HPA069175)

Atlas Antibodies

Catalog No.:
ATL-HPA069175-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adhesion G protein-coupled receptor B2
Gene Name: ADGRB2
Alternative Gene Name: BAI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028782: 94%, ENSRNOG00000014375: 96%
Entrez Gene ID: 576
Uniprot ID: O60241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
Gene Sequence CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
Gene ID - Mouse ENSMUSG00000028782
Gene ID - Rat ENSRNOG00000014375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADGRB2 pAb (ATL-HPA069175)
Datasheet Anti ADGRB2 pAb (ATL-HPA069175) Datasheet (External Link)
Vendor Page Anti ADGRB2 pAb (ATL-HPA069175) at Atlas Antibodies

Documents & Links for Anti ADGRB2 pAb (ATL-HPA069175)
Datasheet Anti ADGRB2 pAb (ATL-HPA069175) Datasheet (External Link)
Vendor Page Anti ADGRB2 pAb (ATL-HPA069175)