Anti ADGRB2 pAb (ATL-HPA069175)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069175-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADGRB2
Alternative Gene Name: BAI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028782: 94%, ENSRNOG00000014375: 96%
Entrez Gene ID: 576
Uniprot ID: O60241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL |
Gene Sequence | CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL |
Gene ID - Mouse | ENSMUSG00000028782 |
Gene ID - Rat | ENSRNOG00000014375 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADGRB2 pAb (ATL-HPA069175) | |
Datasheet | Anti ADGRB2 pAb (ATL-HPA069175) Datasheet (External Link) |
Vendor Page | Anti ADGRB2 pAb (ATL-HPA069175) at Atlas Antibodies |
Documents & Links for Anti ADGRB2 pAb (ATL-HPA069175) | |
Datasheet | Anti ADGRB2 pAb (ATL-HPA069175) Datasheet (External Link) |
Vendor Page | Anti ADGRB2 pAb (ATL-HPA069175) |