Anti ADGB pAb (ATL-HPA036340 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036340-25

Protein Description: androglobin
Gene Name: ADGB
Alternative Gene Name: C6orf103, dJ408K24.1, FLJ23121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050994: 77%, ENSRNOG00000042741: 80%
Entrez Gene ID: 79747
Uniprot ID: Q8N7X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVR
• Gene Sequence: DGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVR
• Gene ID - Mouse: ENSMUSG00000050994
• Gene ID - Rat: ENSRNOG00000042741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADGB pAb (ATL-HPA036340 w/enhanced validation) – 1 Found

Koay, Teng Wei; Osterhof, Carina; Orlando, Ilaria M C; Keppner, Anna; Andre, Daniel; Yousefian, Schayan; Suárez Alonso, María; Correia, Miguel; Markworth, Robert; Schödel, Johannes; Hankeln, Thomas; Hoogewijs, David. Androglobin gene expression patterns and FOXJ1-dependent regulation indicate its functional association with ciliogenesis. The Journal Of Biological Chemistry. 2021;296( 33453283):100291.