Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA034509-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-ADD2 antibody. Corresponding ADD2 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adducin 2 (beta)
Gene Name: ADD2
Alternative Gene Name: ADDB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030000: 98%, ENSRNOG00000015903: 98%
Entrez Gene ID: 119
Uniprot ID: P35612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF
Gene Sequence NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF
Gene ID - Mouse ENSMUSG00000030000
Gene ID - Rat ENSRNOG00000015903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation)
Datasheet Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation)
Datasheet Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADD2 pAb (ATL-HPA034509 w/enhanced validation)