Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035873-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-ADD1 antibody HPA035873 (A) shows similar protein distribution across tissues to independent antibody HPA035874 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & plasma membrane.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: adducin 1 (alpha)
Gene Name: ADD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029106: 72%, ENSRNOG00000013039: 63%
Entrez Gene ID: 118
Uniprot ID: P35611
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRP
Gene Sequence PPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRP
Gene ID - Mouse ENSMUSG00000029106
Gene ID - Rat ENSRNOG00000013039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation)
Datasheet Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation)
Datasheet Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADD1 pAb (ATL-HPA035873 w/enhanced validation)