Anti ADCYAP1R1 pAb (ATL-HPA030739)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030739-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADCYAP1R1
Alternative Gene Name: PAC1, PAC1R, PACAPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029778: 87%, ENSRNOG00000012098: 89%
Entrez Gene ID: 117
Uniprot ID: P41586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ |
| Gene Sequence | KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ |
| Gene ID - Mouse | ENSMUSG00000029778 |
| Gene ID - Rat | ENSRNOG00000012098 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADCYAP1R1 pAb (ATL-HPA030739) | |
| Datasheet | Anti ADCYAP1R1 pAb (ATL-HPA030739) Datasheet (External Link) |
| Vendor Page | Anti ADCYAP1R1 pAb (ATL-HPA030739) at Atlas Antibodies |
| Documents & Links for Anti ADCYAP1R1 pAb (ATL-HPA030739) | |
| Datasheet | Anti ADCYAP1R1 pAb (ATL-HPA030739) Datasheet (External Link) |
| Vendor Page | Anti ADCYAP1R1 pAb (ATL-HPA030739) |