Anti ADCY9 pAb (ATL-HPA041328)

Atlas Antibodies

SKU:
ATL-HPA041328-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenylate cyclase 9
Gene Name: ADCY9
Alternative Gene Name: AC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005580: 92%, ENSRNOG00000049768: 94%
Entrez Gene ID: 115
Uniprot ID: O60503
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQD
Gene Sequence VADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQD
Gene ID - Mouse ENSMUSG00000005580
Gene ID - Rat ENSRNOG00000049768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADCY9 pAb (ATL-HPA041328)
Datasheet Anti ADCY9 pAb (ATL-HPA041328) Datasheet (External Link)
Vendor Page Anti ADCY9 pAb (ATL-HPA041328) at Atlas Antibodies

Documents & Links for Anti ADCY9 pAb (ATL-HPA041328)
Datasheet Anti ADCY9 pAb (ATL-HPA041328) Datasheet (External Link)
Vendor Page Anti ADCY9 pAb (ATL-HPA041328)



Citations for Anti ADCY9 pAb (ATL-HPA041328) – 1 Found
Yi, Hua; Wang, Kun; Jin, Jun-Feng; Jin, He; Yang, Lihua; Zou, Yidan; Du, Biaoyan; Liu, Xiaodong. Elevated Adenylyl Cyclase 9 Expression Is a Potential Prognostic Biomarker for Patients with Colon Cancer. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2018;24( 29292367):19-25.  PubMed