Anti ADCY8 pAb (ATL-HPA024291)

Atlas Antibodies

SKU:
ATL-HPA024291-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adenylate cyclase 8 (brain)
Gene Name: ADCY8
Alternative Gene Name: AC8, ADCY3, HBAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022376: 100%, ENSRNOG00000004890: 100%
Entrez Gene ID: 114
Uniprot ID: P40145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
Gene Sequence DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
Gene ID - Mouse ENSMUSG00000022376
Gene ID - Rat ENSRNOG00000004890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADCY8 pAb (ATL-HPA024291)
Datasheet Anti ADCY8 pAb (ATL-HPA024291) Datasheet (External Link)
Vendor Page Anti ADCY8 pAb (ATL-HPA024291) at Atlas Antibodies

Documents & Links for Anti ADCY8 pAb (ATL-HPA024291)
Datasheet Anti ADCY8 pAb (ATL-HPA024291) Datasheet (External Link)
Vendor Page Anti ADCY8 pAb (ATL-HPA024291)