Anti ADCY8 pAb (ATL-HPA024291)

Atlas Antibodies

Catalog No.: ATL-HPA024291-25

Protein Description: adenylate cyclase 8 (brain)
Gene Name: ADCY8
Alternative Gene Name: AC8, ADCY3, HBAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022376: 100%, ENSRNOG00000004890: 100%
Entrez Gene ID: 114
Uniprot ID: P40145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
• Gene Sequence: DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
• Gene ID - Mouse: ENSMUSG00000022376
• Gene ID - Rat: ENSRNOG00000004890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.