Anti ADCY5 pAb (ATL-HPA077682)

Atlas Antibodies

Catalog No.:
ATL-HPA077682-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenylate cyclase 5
Gene Name: ADCY5
Alternative Gene Name: AC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022840: 79%, ENSRNOG00000002229: 77%
Entrez Gene ID: 111
Uniprot ID: O95622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF
Gene Sequence FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF
Gene ID - Mouse ENSMUSG00000022840
Gene ID - Rat ENSRNOG00000002229
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADCY5 pAb (ATL-HPA077682)
Datasheet Anti ADCY5 pAb (ATL-HPA077682) Datasheet (External Link)
Vendor Page Anti ADCY5 pAb (ATL-HPA077682) at Atlas Antibodies

Documents & Links for Anti ADCY5 pAb (ATL-HPA077682)
Datasheet Anti ADCY5 pAb (ATL-HPA077682) Datasheet (External Link)
Vendor Page Anti ADCY5 pAb (ATL-HPA077682)