Anti ADCY2 pAb (ATL-HPA038483)

Atlas Antibodies

Catalog No.:
ATL-HPA038483-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adenylate cyclase 2 (brain)
Gene Name: ADCY2
Alternative Gene Name: AC2, HBAC2, KIAA1060
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021536: 98%, ENSRNOG00000032150: 98%
Entrez Gene ID: 108
Uniprot ID: Q08462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK
Gene Sequence HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK
Gene ID - Mouse ENSMUSG00000021536
Gene ID - Rat ENSRNOG00000032150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADCY2 pAb (ATL-HPA038483)
Datasheet Anti ADCY2 pAb (ATL-HPA038483) Datasheet (External Link)
Vendor Page Anti ADCY2 pAb (ATL-HPA038483) at Atlas Antibodies

Documents & Links for Anti ADCY2 pAb (ATL-HPA038483)
Datasheet Anti ADCY2 pAb (ATL-HPA038483) Datasheet (External Link)
Vendor Page Anti ADCY2 pAb (ATL-HPA038483)