Anti ADCK5 pAb (ATL-HPA025692)

Atlas Antibodies

SKU:
ATL-HPA025692-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in asterocyte-like cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aarF domain containing kinase 5
Gene Name: ADCK5
Alternative Gene Name: FLJ35454
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022550: 87%, ENSRNOG00000030334: 89%
Entrez Gene ID: 203054
Uniprot ID: Q3MIX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGVEENSPGYLEVMSACHQRAADALVAGAISNGGLYVKLGQGLCSFNHLLPPEYTRTLRVLEDRALKRGFQEVDELFLEDFQALPHELFQEFD
Gene Sequence RGVEENSPGYLEVMSACHQRAADALVAGAISNGGLYVKLGQGLCSFNHLLPPEYTRTLRVLEDRALKRGFQEVDELFLEDFQALPHELFQEFD
Gene ID - Mouse ENSMUSG00000022550
Gene ID - Rat ENSRNOG00000030334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADCK5 pAb (ATL-HPA025692)
Datasheet Anti ADCK5 pAb (ATL-HPA025692) Datasheet (External Link)
Vendor Page Anti ADCK5 pAb (ATL-HPA025692) at Atlas Antibodies

Documents & Links for Anti ADCK5 pAb (ATL-HPA025692)
Datasheet Anti ADCK5 pAb (ATL-HPA025692) Datasheet (External Link)
Vendor Page Anti ADCK5 pAb (ATL-HPA025692)