Anti ADCK2 pAb (ATL-HPA036036)

Atlas Antibodies

Catalog No.: ATL-HPA036036-25

Protein Description: aarF domain containing kinase 2
Gene Name: ADCK2
Alternative Gene Name: MGC20727
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046947: 88%, ENSRNOG00000010005: 88%
Entrez Gene ID: 90956
Uniprot ID: Q7Z695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKL
• Gene Sequence: LVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKL
• Gene ID - Mouse: ENSMUSG00000046947
• Gene ID - Rat: ENSRNOG00000010005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADCK2 pAb (ATL-HPA036036) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.