Anti ADCK2 pAb (ATL-HPA036036)

Atlas Antibodies

Catalog No.:
ATL-HPA036036-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aarF domain containing kinase 2
Gene Name: ADCK2
Alternative Gene Name: MGC20727
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046947: 88%, ENSRNOG00000010005: 88%
Entrez Gene ID: 90956
Uniprot ID: Q7Z695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKL
Gene Sequence LVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKL
Gene ID - Mouse ENSMUSG00000046947
Gene ID - Rat ENSRNOG00000010005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADCK2 pAb (ATL-HPA036036)
Datasheet Anti ADCK2 pAb (ATL-HPA036036) Datasheet (External Link)
Vendor Page Anti ADCK2 pAb (ATL-HPA036036) at Atlas Antibodies

Documents & Links for Anti ADCK2 pAb (ATL-HPA036036)
Datasheet Anti ADCK2 pAb (ATL-HPA036036) Datasheet (External Link)
Vendor Page Anti ADCK2 pAb (ATL-HPA036036)
Citations for Anti ADCK2 pAb (ATL-HPA036036) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed