Anti ADCK1 pAb (ATL-HPA051012)

Atlas Antibodies

Catalog No.:
ATL-HPA051012-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aarF domain containing kinase 1
Gene Name: ADCK1
Alternative Gene Name: FLJ39600
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021044: 93%, ENSRNOG00000030334: 30%
Entrez Gene ID: 57143
Uniprot ID: Q86TW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE
Gene Sequence YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE
Gene ID - Mouse ENSMUSG00000021044
Gene ID - Rat ENSRNOG00000030334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADCK1 pAb (ATL-HPA051012)
Datasheet Anti ADCK1 pAb (ATL-HPA051012) Datasheet (External Link)
Vendor Page Anti ADCK1 pAb (ATL-HPA051012) at Atlas Antibodies

Documents & Links for Anti ADCK1 pAb (ATL-HPA051012)
Datasheet Anti ADCK1 pAb (ATL-HPA051012) Datasheet (External Link)
Vendor Page Anti ADCK1 pAb (ATL-HPA051012)
Citations for Anti ADCK1 pAb (ATL-HPA051012) – 1 Found
Ji, Yong; Liu, Yiqian; Sun, Changchun; Yu, Lijiang; Wang, Zhao; Du, Xu; Yang, Wu; Zhang, Chenggong; Tao, Chunmu; Wang, Jianjiang; Yang, Xi; Di, Sun; Huang, Yufeng. ADCK1 activates the β-catenin/TCF signaling pathway to promote the growth and migration of colon cancer cells. Cell Death & Disease. 2021;12(4):354.  PubMed