Anti ADAT3 pAb (ATL-HPA058899)

Atlas Antibodies

Catalog No.:
ATL-HPA058899-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenosine deaminase, tRNA-specific 3
Gene Name: ADAT3
Alternative Gene Name: TAD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035370: 86%, ENSRNOG00000014375: 26%
Entrez Gene ID: 113179
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD
Gene Sequence GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD
Gene ID - Mouse ENSMUSG00000035370
Gene ID - Rat ENSRNOG00000014375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAT3 pAb (ATL-HPA058899)
Datasheet Anti ADAT3 pAb (ATL-HPA058899) Datasheet (External Link)
Vendor Page Anti ADAT3 pAb (ATL-HPA058899) at Atlas Antibodies

Documents & Links for Anti ADAT3 pAb (ATL-HPA058899)
Datasheet Anti ADAT3 pAb (ATL-HPA058899) Datasheet (External Link)
Vendor Page Anti ADAT3 pAb (ATL-HPA058899)