Anti ADAT3 pAb (ATL-HPA058899)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058899-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADAT3
Alternative Gene Name: TAD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035370: 86%, ENSRNOG00000014375: 26%
Entrez Gene ID: 113179
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD |
Gene Sequence | GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD |
Gene ID - Mouse | ENSMUSG00000035370 |
Gene ID - Rat | ENSRNOG00000014375 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAT3 pAb (ATL-HPA058899) | |
Datasheet | Anti ADAT3 pAb (ATL-HPA058899) Datasheet (External Link) |
Vendor Page | Anti ADAT3 pAb (ATL-HPA058899) at Atlas Antibodies |
Documents & Links for Anti ADAT3 pAb (ATL-HPA058899) | |
Datasheet | Anti ADAT3 pAb (ATL-HPA058899) Datasheet (External Link) |
Vendor Page | Anti ADAT3 pAb (ATL-HPA058899) |