Anti ADAT2 pAb (ATL-HPA035479)

Atlas Antibodies

SKU:
ATL-HPA035479-25
  • Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenosine deaminase, tRNA-specific 2
Gene Name: ADAT2
Alternative Gene Name: DEADC1, dJ20N2.1, TAD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019808: 82%, ENSRNOG00000046983: 77%
Entrez Gene ID: 134637
Uniprot ID: Q7Z6V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFE
Gene Sequence PKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFE
Gene ID - Mouse ENSMUSG00000019808
Gene ID - Rat ENSRNOG00000046983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADAT2 pAb (ATL-HPA035479)
Datasheet Anti ADAT2 pAb (ATL-HPA035479) Datasheet (External Link)
Vendor Page Anti ADAT2 pAb (ATL-HPA035479) at Atlas Antibodies

Documents & Links for Anti ADAT2 pAb (ATL-HPA035479)
Datasheet Anti ADAT2 pAb (ATL-HPA035479) Datasheet (External Link)
Vendor Page Anti ADAT2 pAb (ATL-HPA035479)