Anti ADAT1 pAb (ATL-HPA040903)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040903-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADAT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031949: 75%, ENSRNOG00000019434: 73%
Entrez Gene ID: 23536
Uniprot ID: Q9BUB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPD |
Gene Sequence | YLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPD |
Gene ID - Mouse | ENSMUSG00000031949 |
Gene ID - Rat | ENSRNOG00000019434 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAT1 pAb (ATL-HPA040903) | |
Datasheet | Anti ADAT1 pAb (ATL-HPA040903) Datasheet (External Link) |
Vendor Page | Anti ADAT1 pAb (ATL-HPA040903) at Atlas Antibodies |
Documents & Links for Anti ADAT1 pAb (ATL-HPA040903) | |
Datasheet | Anti ADAT1 pAb (ATL-HPA040903) Datasheet (External Link) |
Vendor Page | Anti ADAT1 pAb (ATL-HPA040903) |