Anti ADAT1 pAb (ATL-HPA040713)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040713-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/91086/166034/atl-hpa040713_anti-adat1-pab-atl-hpa040713_47678__83173.1681118801.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADAT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031949: 84%, ENSRNOG00000019434: 87%
Entrez Gene ID: 23536
Uniprot ID: Q9BUB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR |
| Gene Sequence | IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR |
| Gene ID - Mouse | ENSMUSG00000031949 |
| Gene ID - Rat | ENSRNOG00000019434 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADAT1 pAb (ATL-HPA040713) | |
| Datasheet | Anti ADAT1 pAb (ATL-HPA040713) Datasheet (External Link) |
| Vendor Page | Anti ADAT1 pAb (ATL-HPA040713) at Atlas Antibodies |
| Documents & Links for Anti ADAT1 pAb (ATL-HPA040713) | |
| Datasheet | Anti ADAT1 pAb (ATL-HPA040713) Datasheet (External Link) |
| Vendor Page | Anti ADAT1 pAb (ATL-HPA040713) |
| Citations for Anti ADAT1 pAb (ATL-HPA040713) – 1 Found |
| Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |