Anti ADAT1 pAb (ATL-HPA040713)

Atlas Antibodies

SKU: ATL-HPA040713-25

• 
• 
• 

Protein Description: adenosine deaminase, tRNA-specific 1
Gene Name: ADAT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031949: 84%, ENSRNOG00000019434: 87%
Entrez Gene ID: 23536
Uniprot ID: Q9BUB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR
• Gene Sequence: IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR
• Gene ID - Mouse: ENSMUSG00000031949
• Gene ID - Rat: ENSRNOG00000019434
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAT1 pAb (ATL-HPA040713) – 1 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759.