Anti ADAT1 pAb (ATL-HPA040713)

Atlas Antibodies

Catalog No.:
ATL-HPA040713-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adenosine deaminase, tRNA-specific 1
Gene Name: ADAT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031949: 84%, ENSRNOG00000019434: 87%
Entrez Gene ID: 23536
Uniprot ID: Q9BUB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR
Gene Sequence IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR
Gene ID - Mouse ENSMUSG00000031949
Gene ID - Rat ENSRNOG00000019434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAT1 pAb (ATL-HPA040713)
Datasheet Anti ADAT1 pAb (ATL-HPA040713) Datasheet (External Link)
Vendor Page Anti ADAT1 pAb (ATL-HPA040713) at Atlas Antibodies

Documents & Links for Anti ADAT1 pAb (ATL-HPA040713)
Datasheet Anti ADAT1 pAb (ATL-HPA040713) Datasheet (External Link)
Vendor Page Anti ADAT1 pAb (ATL-HPA040713)
Citations for Anti ADAT1 pAb (ATL-HPA040713) – 1 Found
Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759.  PubMed