Anti ADARB1 pAb (ATL-HPA018277)

Atlas Antibodies

Catalog No.:
ATL-HPA018277-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: adenosine deaminase, RNA-specific, B1
Gene Name: ADARB1
Alternative Gene Name: ADAR2, ADAR2a, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, DRABA2, DRADA2, hRED1, RED1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020262: 95%, ENSRNOG00000001227: 95%
Entrez Gene ID: 104
Uniprot ID: P78563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV
Gene Sequence SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV
Gene ID - Mouse ENSMUSG00000020262
Gene ID - Rat ENSRNOG00000001227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADARB1 pAb (ATL-HPA018277)
Datasheet Anti ADARB1 pAb (ATL-HPA018277) Datasheet (External Link)
Vendor Page Anti ADARB1 pAb (ATL-HPA018277) at Atlas Antibodies

Documents & Links for Anti ADARB1 pAb (ATL-HPA018277)
Datasheet Anti ADARB1 pAb (ATL-HPA018277) Datasheet (External Link)
Vendor Page Anti ADARB1 pAb (ATL-HPA018277)
Citations for Anti ADARB1 pAb (ATL-HPA018277) – 8 Found
Anantharaman, Aparna; Tripathi, Vidisha; Khan, Abid; Yoon, Je-Hyun; Singh, Deepak K; Gholamalamdari, Omid; Guang, Shuomeng; Ohlson, Johan; Wahlstedt, Helene; Öhman, Marie; Jantsch, Michael F; Conrad, Nicholas K; Ma, Jian; Gorospe, Myriam; Prasanth, Supriya G; Prasanth, Kannanganattu V. ADAR2 regulates RNA stability by modifying access of decay-promoting RNA-binding proteins. Nucleic Acids Research. 2017;45(7):4189-4201.  PubMed
Fritzell, Kajsa; Xu, Li-Di; Otrocka, Magdalena; Andréasson, Claes; Öhman, Marie. Sensitive ADAR editing reporter in cancer cells enables high-throughput screening of small molecule libraries. Nucleic Acids Research. 2019;47(4):e22.  PubMed
Siqueira, Edilene; Obiols-Guardia, Aida; Jorge-Torres, Olga C; Oliveira-Mateos, Cristina; Soler, Marta; Ramesh-Kumar, Deepthi; Setién, Fernando; van Rossum, Daniëlle; Pascual-Alonso, Ainhoa; Xiol, Clara; Ivan, Cristina; Shimizu, Masayoshi; Armstrong, Judith; Calin, George A; Pasterkamp, R Jeroen; Esteller, Manel; Guil, Sonia. Analysis of the circRNA and T-UCR populations identifies convergent pathways in mouse and human models of Rett syndrome. Molecular Therapy. Nucleic Acids. 2022;27( 35036070):621-644.  PubMed
Widmark, Albin; Sagredo, Eduardo A; Karlström, Victor; Behm, Mikaela; Biryukova, Inna; Friedländer, Marc R; Daniel, Chammiran; Öhman, Marie. ADAR1- and ADAR2-mediated regulation of maturation and targeting of miR-376b to modulate GABA neurotransmitter catabolism. The Journal Of Biological Chemistry. 2022;298(3):101682.  PubMed
Witman, Nevin M; Behm, Mikaela; Ohman, Marie; Morrison, Jamie I. ADAR-related activation of adenosine-to-inosine RNA editing during regeneration. Stem Cells And Development. 2013;22(16):2254-67.  PubMed
Deng, Patricia; Khan, Anzer; Jacobson, Dionna; Sambrani, Nagraj; McGurk, Leeanne; Li, Xianghua; Jayasree, Aswathy; Hejatko, Jan; Shohat-Ophir, Galit; O'Connell, Mary A; Li, Jin Billy; Keegan, Liam P. Adar RNA editing-dependent and -independent effects are required for brain and innate immune functions in Drosophila. Nature Communications. 2020;11(1):1580.  PubMed
Soler, Marta; Davalos, Veronica; Sánchez-Castillo, Anaís; Mora-Martinez, Carlos; Setién, Fernando; Siqueira, Edilene; Castro de Moura, Manuel; Esteller, Manel; Guil, Sonia. The transcribed ultraconserved region uc.160+ enhances processing and A-to-I editing of the miR-376 cluster: hypermethylation improves glioma prognosis. Molecular Oncology. 2022;16(3):648-664.  PubMed
Hariharan, Ananya; Qi, Weihong; Rehrauer, Hubert; Wu, Licun; Ronner, Manuel; Wipplinger, Martin; Kresoja-Rakic, Jelena; Sun, Suna; Oton-Gonzalez, Lucia; Sculco, Marika; Serre-Beinier, Véronique; Meiller, Clément; Blanquart, Christophe; Fonteneau, Jean-François; Vrugt, Bart; Rüschoff, Jan Hendrik; Opitz, Isabelle; Jean, Didier; de Perrot, Marc; Felley-Bosco, Emanuela. Heterogeneous RNA editing and influence of ADAR2 on mesothelioma chemoresistance and the tumor microenvironment. Molecular Oncology. 2022;16(22):3949-3974.  PubMed