Anti ADAR pAb (ATL-HPA003890 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003890-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA003890 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli.
  • Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADAR antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: adenosine deaminase, RNA-specific
Gene Name: ADAR
Alternative Gene Name: ADAR1, G1P1, IFI4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027951: 86%, ENSRNOG00000020744: 85%
Entrez Gene ID: 103
Uniprot ID: P55265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
Gene Sequence SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
Gene ID - Mouse ENSMUSG00000027951
Gene ID - Rat ENSRNOG00000020744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADAR pAb (ATL-HPA003890 w/enhanced validation)
Datasheet Anti ADAR pAb (ATL-HPA003890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADAR pAb (ATL-HPA003890 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADAR pAb (ATL-HPA003890 w/enhanced validation)
Datasheet Anti ADAR pAb (ATL-HPA003890 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADAR pAb (ATL-HPA003890 w/enhanced validation)



Citations for Anti ADAR pAb (ATL-HPA003890 w/enhanced validation) – 10 Found
Rehrauer, Hubert; Wu, Licun; Blum, Walter; Pecze, Lazslo; Henzi, Thomas; Serre-Beinier, Véronique; Aquino, Catherine; Vrugt, Bart; de Perrot, Marc; Schwaller, Beat; Felley-Bosco, Emanuela. How asbestos drives the tissue towards tumors: YAP activation, macrophage and mesothelial precursor recruitment, RNA editing, and somatic mutations. Oncogene. 2018;37(20):2645-2659.  PubMed
Shallev, Lea; Kopel, Eli; Feiglin, Ariel; Leichner, Gil S; Avni, Dror; Sidi, Yechezkel; Eisenberg, Eli; Barzilai, Aviv; Levanon, Erez Y; Greenberger, Shoshana. Decreased A-to-I RNA editing as a source of keratinocytes' dsRNA in psoriasis. Rna (New York, N.y.). 2018;24(6):828-840.  PubMed
Abukar, Asra; Wipplinger, Martin; Hariharan, Ananya; Sun, Suna; Ronner, Manuel; Sculco, Marika; Okonska, Agata; Kresoja-Rakic, Jelena; Rehrauer, Hubert; Qi, Weihong; Beusechem, Victor W van; Felley-Bosco, Emanuela. Double-Stranded RNA Structural Elements Holding the Key to Translational Regulation in Cancer: The Case of Editing in RNA-Binding Motif Protein 8A. Cells. 2021;10(12)  PubMed
Rice, Gillian I; Kasher, Paul R; Forte, Gabriella M A; Mannion, Niamh M; Greenwood, Sam M; Szynkiewicz, Marcin; Dickerson, Jonathan E; Bhaskar, Sanjeev S; Zampini, Massimiliano; Briggs, Tracy A; Jenkinson, Emma M; Bacino, Carlos A; Battini, Roberta; Bertini, Enrico; Brogan, Paul A; Brueton, Louise A; Carpanelli, Marialuisa; De Laet, Corinne; de Lonlay, Pascale; del Toro, Mireia; Desguerre, Isabelle; Fazzi, Elisa; Garcia-Cazorla, Angels; Heiberg, Arvid; Kawaguchi, Masakazu; Kumar, Ram; Lin, Jean-Pierre S-M; Lourenco, Charles M; Male, Alison M; Marques, Wilson Jr; Mignot, Cyril; Olivieri, Ivana; Orcesi, Simona; Prabhakar, Prab; Rasmussen, Magnhild; Robinson, Robert A; Rozenberg, Flore; Schmidt, Johanna L; Steindl, Katharina; Tan, Tiong Y; van der Merwe, William G; Vanderver, Adeline; Vassallo, Grace; Wakeling, Emma L; Wassmer, Evangeline; Whittaker, Elizabeth; Livingston, John H; Lebon, Pierre; Suzuki, Tamio; McLaughlin, Paul J; Keegan, Liam P; O'Connell, Mary A; Lovell, Simon C; Crow, Yanick J. Mutations in ADAR1 cause Aicardi-Goutières syndrome associated with a type I interferon signature. Nature Genetics. 2012;44(11):1243-8.  PubMed
Witman, Nevin M; Behm, Mikaela; Ohman, Marie; Morrison, Jamie I. ADAR-related activation of adenosine-to-inosine RNA editing during regeneration. Stem Cells And Development. 2013;22(16):2254-67.  PubMed
Nachmani, Daphna; Zimmermann, Albert; Oiknine Djian, Esther; Weisblum, Yiska; Livneh, Yoav; Khanh Le, Vu Thuy; Galun, Eithan; Horejsi, Vaclav; Isakov, Ofer; Shomron, Noam; Wolf, Dana G; Hengel, Hartmut; Mandelboim, Ofer. MicroRNA editing facilitates immune elimination of HCMV infected cells. Plos Pathogens. 2014;10(2):e1003963.  PubMed
Galore-Haskel, Gilli; Nemlich, Yael; Greenberg, Eyal; Ashkenazi, Shira; Hakim, Motti; Itzhaki, Orit; Shoshani, Noa; Shapira-Fromer, Ronnie; Ben-Ami, Eytan; Ofek, Efrat; Anafi, Liat; Besser, Michal J; Schachter, Jacob; Markel, Gal. A novel immune resistance mechanism of melanoma cells controlled by the ADAR1 enzyme. Oncotarget. 2015;6(30):28999-9015.  PubMed
Ben-Shoshan, Shirley Oren; Kagan, Polina; Sultan, Maya; Barabash, Zohar; Dor, Chen; Jacob-Hirsch, Jasmine; Harmelin, Alon; Pappo, Orit; Marcu-Malina, Victoria; Ben-Ari, Ziv; Amariglio, Ninette; Rechavi, Gideon; Goldstein, Itamar; Safran, Michal. ADAR1 deletion induces NFκB and interferon signaling dependent liver inflammation and fibrosis. Rna Biology. 2017;14(5):587-602.  PubMed
Hariharan, Ananya; Qi, Weihong; Rehrauer, Hubert; Wu, Licun; Ronner, Manuel; Wipplinger, Martin; Kresoja-Rakic, Jelena; Sun, Suna; Oton-Gonzalez, Lucia; Sculco, Marika; Serre-Beinier, Véronique; Meiller, Clément; Blanquart, Christophe; Fonteneau, Jean-François; Vrugt, Bart; Rüschoff, Jan Hendrik; Opitz, Isabelle; Jean, Didier; de Perrot, Marc; Felley-Bosco, Emanuela. Heterogeneous RNA editing and influence of ADAR2 on mesothelioma chemoresistance and the tumor microenvironment. Molecular Oncology. 2022;16(22):3949-3974.  PubMed
Hao, Xue; Shiromoto, Yusuke; Sakurai, Masayuki; Towers, Martina; Zhang, Qiang; Wu, Shuai; Havas, Aaron; Wang, Lu; Berger, Shelley; Adams, Peter D; Tian, Bin; Nishikura, Kazuko; Kossenkov, Andrew V; Liu, Pingyu; Zhang, Rugang. ADAR1 downregulation by autophagy drives senescence independently of RNA editing by enhancing p16(INK4a) levels. Nature Cell Biology. 2022;24(8):1202-1210.  PubMed