Anti ADAP1 pAb (ATL-HPA007033)

Atlas Antibodies

Catalog No.:
ATL-HPA007033-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ArfGAP with dual PH domains 1
Gene Name: ADAP1
Alternative Gene Name: CENTA1, GCS1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056413: 94%, ENSRNOG00000054033: 94%
Entrez Gene ID: 11033
Uniprot ID: O75689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
Gene Sequence PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
Gene ID - Mouse ENSMUSG00000056413
Gene ID - Rat ENSRNOG00000054033
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAP1 pAb (ATL-HPA007033)
Datasheet Anti ADAP1 pAb (ATL-HPA007033) Datasheet (External Link)
Vendor Page Anti ADAP1 pAb (ATL-HPA007033) at Atlas Antibodies

Documents & Links for Anti ADAP1 pAb (ATL-HPA007033)
Datasheet Anti ADAP1 pAb (ATL-HPA007033) Datasheet (External Link)
Vendor Page Anti ADAP1 pAb (ATL-HPA007033)