Anti ADAMTSL5 pAb (ATL-HPA044050)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044050-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADAMTSL5
Alternative Gene Name: THSD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043822: 83%, ENSRNOG00000008634: 26%
Entrez Gene ID: 339366
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
Gene Sequence | AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
Gene ID - Mouse | ENSMUSG00000043822 |
Gene ID - Rat | ENSRNOG00000008634 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAMTSL5 pAb (ATL-HPA044050) | |
Datasheet | Anti ADAMTSL5 pAb (ATL-HPA044050) Datasheet (External Link) |
Vendor Page | Anti ADAMTSL5 pAb (ATL-HPA044050) at Atlas Antibodies |
Documents & Links for Anti ADAMTSL5 pAb (ATL-HPA044050) | |
Datasheet | Anti ADAMTSL5 pAb (ATL-HPA044050) Datasheet (External Link) |
Vendor Page | Anti ADAMTSL5 pAb (ATL-HPA044050) |
Citations for Anti ADAMTSL5 pAb (ATL-HPA044050) – 1 Found |
Pouw, Juliëtte N; Olde Nordkamp, Michel A M; van Kempen, Tessa; Concepcion, Arno N; van Laar, Jacob M; van Wijk, Femke; Spierings, Julia; Leijten, Emmerik F A; Boes, Marianne. Regulatory T cells in psoriatic arthritis: an IL-17A-producing, Foxp3(int)CD161 + RORγt + ICOS + phenotype, that associates with the presence of ADAMTSL5 autoantibodies. Scientific Reports. 2022;12(1):20675. PubMed |