Anti ADAMTSL5 pAb (ATL-HPA044050)

Atlas Antibodies

SKU: ATL-HPA044050-25

• 
• 

Protein Description: ADAMTS-like 5
Gene Name: ADAMTSL5
Alternative Gene Name: THSD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043822: 83%, ENSRNOG00000008634: 26%
Entrez Gene ID: 339366
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ
• Gene Sequence: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ
• Gene ID - Mouse: ENSMUSG00000043822
• Gene ID - Rat: ENSRNOG00000008634
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAMTSL5 pAb (ATL-HPA044050) – 1 Found

Pouw, Juliëtte N; Olde Nordkamp, Michel A M; van Kempen, Tessa; Concepcion, Arno N; van Laar, Jacob M; van Wijk, Femke; Spierings, Julia; Leijten, Emmerik F A; Boes, Marianne. Regulatory T cells in psoriatic arthritis: an IL-17A-producing, Foxp3(int)CD161 + RORγt + ICOS + phenotype, that associates with the presence of ADAMTSL5 autoantibodies. Scientific Reports. 2022;12(1):20675.