Anti ADAMTSL3 pAb (ATL-HPA034774)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034774-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADAMTSL3
Alternative Gene Name: KIAA1233, punctin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 69%, ENSRNOG00000010840: 71%
Entrez Gene ID: 57188
Uniprot ID: P82987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGH |
Gene Sequence | LSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGH |
Gene ID - Mouse | ENSMUSG00000070469 |
Gene ID - Rat | ENSRNOG00000010840 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAMTSL3 pAb (ATL-HPA034774) | |
Datasheet | Anti ADAMTSL3 pAb (ATL-HPA034774) Datasheet (External Link) |
Vendor Page | Anti ADAMTSL3 pAb (ATL-HPA034774) at Atlas Antibodies |
Documents & Links for Anti ADAMTSL3 pAb (ATL-HPA034774) | |
Datasheet | Anti ADAMTSL3 pAb (ATL-HPA034774) Datasheet (External Link) |
Vendor Page | Anti ADAMTSL3 pAb (ATL-HPA034774) |