Anti ADAMTSL3 pAb (ATL-HPA034773)

Atlas Antibodies

SKU:
ATL-HPA034773-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADAMTS-like 3
Gene Name: ADAMTSL3
Alternative Gene Name: KIAA1233, punctin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 75%, ENSRNOG00000010840: 74%
Entrez Gene ID: 57188
Uniprot ID: P82987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIR
Gene Sequence ALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIR
Gene ID - Mouse ENSMUSG00000070469
Gene ID - Rat ENSRNOG00000010840
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADAMTSL3 pAb (ATL-HPA034773)
Datasheet Anti ADAMTSL3 pAb (ATL-HPA034773) Datasheet (External Link)
Vendor Page Anti ADAMTSL3 pAb (ATL-HPA034773) at Atlas Antibodies

Documents & Links for Anti ADAMTSL3 pAb (ATL-HPA034773)
Datasheet Anti ADAMTSL3 pAb (ATL-HPA034773) Datasheet (External Link)
Vendor Page Anti ADAMTSL3 pAb (ATL-HPA034773)



Citations for Anti ADAMTSL3 pAb (ATL-HPA034773) – 1 Found
Rypdal, Karoline B; Olav Melleby, A; Robinson, Emma L; Li, Jia; Palmero, Sheryl; Seifert, Deborah E; Martin, Daniel; Clark, Catelyn; López, Begoña; Andreassen, Kristine; Dahl, Christen P; Sjaastad, Ivar; Tønnessen, Theis; Stokke, Mathis K; Louch, William E; González, Arantxa; Heymans, Stephane; Christensen, Geir; Apte, Suneel S; Lunde, Ida G. ADAMTSL3 knock-out mice develop cardiac dysfunction and dilatation with increased TGFβ signalling after pressure overload. Communications Biology. 2022;5(1):1392.  PubMed