Anti ADAMTSL3 pAb (ATL-HPA034773)

Atlas Antibodies

Catalog No.: ATL-HPA034773-25

Protein Description: ADAMTS-like 3
Gene Name: ADAMTSL3
Alternative Gene Name: KIAA1233, punctin-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070469: 75%, ENSRNOG00000010840: 74%
Entrez Gene ID: 57188
Uniprot ID: P82987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIR
• Gene Sequence: ALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIR
• Gene ID - Mouse: ENSMUSG00000070469
• Gene ID - Rat: ENSRNOG00000010840
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAMTSL3 pAb (ATL-HPA034773) – 1 Found

Rypdal, Karoline B; Olav Melleby, A; Robinson, Emma L; Li, Jia; Palmero, Sheryl; Seifert, Deborah E; Martin, Daniel; Clark, Catelyn; López, Begoña; Andreassen, Kristine; Dahl, Christen P; Sjaastad, Ivar; Tønnessen, Theis; Stokke, Mathis K; Louch, William E; González, Arantxa; Heymans, Stephane; Christensen, Geir; Apte, Suneel S; Lunde, Ida G. ADAMTSL3 knock-out mice develop cardiac dysfunction and dilatation with increased TGFβ signalling after pressure overload. Communications Biology. 2022;5(1):1392.