Anti ADAMTSL2 pAb (ATL-HPA053812)

Atlas Antibodies

Catalog No.:
ATL-HPA053812-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADAMTS-like 2
Gene Name: ADAMTSL2
Alternative Gene Name: KIAA0605
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036040: 98%, ENSRNOG00000027742: 100%
Entrez Gene ID: 9719
Uniprot ID: Q86TH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMSAYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQPRWETSSWSECS
Gene Sequence VMSAYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQPRWETSSWSECS
Gene ID - Mouse ENSMUSG00000036040
Gene ID - Rat ENSRNOG00000027742
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTSL2 pAb (ATL-HPA053812)
Datasheet Anti ADAMTSL2 pAb (ATL-HPA053812) Datasheet (External Link)
Vendor Page Anti ADAMTSL2 pAb (ATL-HPA053812) at Atlas Antibodies

Documents & Links for Anti ADAMTSL2 pAb (ATL-HPA053812)
Datasheet Anti ADAMTSL2 pAb (ATL-HPA053812) Datasheet (External Link)
Vendor Page Anti ADAMTSL2 pAb (ATL-HPA053812)