Anti ADAMTS9 pAb (ATL-HPA028601)

Atlas Antibodies

Catalog No.:
ATL-HPA028601-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 9
Gene Name: ADAMTS9
Alternative Gene Name: KIAA1312
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030022: 83%, ENSRNOG00000023257: 85%
Entrez Gene ID: 56999
Uniprot ID: Q9P2N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL
Gene Sequence KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL
Gene ID - Mouse ENSMUSG00000030022
Gene ID - Rat ENSRNOG00000023257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS9 pAb (ATL-HPA028601)
Datasheet Anti ADAMTS9 pAb (ATL-HPA028601) Datasheet (External Link)
Vendor Page Anti ADAMTS9 pAb (ATL-HPA028601) at Atlas Antibodies

Documents & Links for Anti ADAMTS9 pAb (ATL-HPA028601)
Datasheet Anti ADAMTS9 pAb (ATL-HPA028601) Datasheet (External Link)
Vendor Page Anti ADAMTS9 pAb (ATL-HPA028601)