Anti ADAMTS9 pAb (ATL-HPA028601)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028601-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADAMTS9
Alternative Gene Name: KIAA1312
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030022: 83%, ENSRNOG00000023257: 85%
Entrez Gene ID: 56999
Uniprot ID: Q9P2N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL |
Gene Sequence | KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL |
Gene ID - Mouse | ENSMUSG00000030022 |
Gene ID - Rat | ENSRNOG00000023257 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAMTS9 pAb (ATL-HPA028601) | |
Datasheet | Anti ADAMTS9 pAb (ATL-HPA028601) Datasheet (External Link) |
Vendor Page | Anti ADAMTS9 pAb (ATL-HPA028601) at Atlas Antibodies |
Documents & Links for Anti ADAMTS9 pAb (ATL-HPA028601) | |
Datasheet | Anti ADAMTS9 pAb (ATL-HPA028601) Datasheet (External Link) |
Vendor Page | Anti ADAMTS9 pAb (ATL-HPA028601) |