Anti ADAMTS9 pAb (ATL-HPA028577)

Atlas Antibodies

Catalog No.:
ATL-HPA028577-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 9
Gene Name: ADAMTS9
Alternative Gene Name: KIAA1312
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030022: 78%, ENSRNOG00000023257: 77%
Entrez Gene ID: 56999
Uniprot ID: Q9P2N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGD
Gene Sequence GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGD
Gene ID - Mouse ENSMUSG00000030022
Gene ID - Rat ENSRNOG00000023257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS9 pAb (ATL-HPA028577)
Datasheet Anti ADAMTS9 pAb (ATL-HPA028577) Datasheet (External Link)
Vendor Page Anti ADAMTS9 pAb (ATL-HPA028577) at Atlas Antibodies

Documents & Links for Anti ADAMTS9 pAb (ATL-HPA028577)
Datasheet Anti ADAMTS9 pAb (ATL-HPA028577) Datasheet (External Link)
Vendor Page Anti ADAMTS9 pAb (ATL-HPA028577)
Citations for Anti ADAMTS9 pAb (ATL-HPA028577) – 1 Found
Peluffo, Marina C; Murphy, Melinda J; Baughman, Serena Talcott; Stouffer, Richard L; Hennebold, Jon D. Systematic analysis of protease gene expression in the rhesus macaque ovulatory follicle: metalloproteinase involvement in follicle rupture. Endocrinology. 2011;152(10):3963-74.  PubMed