Anti ADAMTS9 pAb (ATL-HPA028567)

Atlas Antibodies

SKU: ATL-HPA028567-25

• 
• 

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 9
Gene Name: ADAMTS9
Alternative Gene Name: KIAA1312
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030022: 89%, ENSRNOG00000023257: 83%
Entrez Gene ID: 56999
Uniprot ID: Q9P2N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC
• Gene Sequence: VMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTC
• Gene ID - Mouse: ENSMUSG00000030022
• Gene ID - Rat: ENSRNOG00000023257
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.