Anti ADAMTS7 pAb (ATL-HPA045284)

Atlas Antibodies

Catalog No.:
ATL-HPA045284-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 7
Gene Name: ADAMTS7
Alternative Gene Name: ADAM-TS7, DKFZp434H204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032363: 76%, ENSRNOG00000028036: 71%
Entrez Gene ID: 11173
Uniprot ID: Q9UKP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Gene Sequence LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN
Gene ID - Mouse ENSMUSG00000032363
Gene ID - Rat ENSRNOG00000028036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS7 pAb (ATL-HPA045284)
Datasheet Anti ADAMTS7 pAb (ATL-HPA045284) Datasheet (External Link)
Vendor Page Anti ADAMTS7 pAb (ATL-HPA045284) at Atlas Antibodies

Documents & Links for Anti ADAMTS7 pAb (ATL-HPA045284)
Datasheet Anti ADAMTS7 pAb (ATL-HPA045284) Datasheet (External Link)
Vendor Page Anti ADAMTS7 pAb (ATL-HPA045284)