Anti ADAMTS5 pAb (ATL-HPA005661)

Atlas Antibodies

Catalog No.:
ATL-HPA005661-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 5
Gene Name: ADAMTS5
Alternative Gene Name: ADAMTS11, ADMP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022894: 85%, ENSRNOG00000057794: 84%
Entrez Gene ID: 11096
Uniprot ID: Q9UNA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS
Gene Sequence KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS
Gene ID - Mouse ENSMUSG00000022894
Gene ID - Rat ENSRNOG00000057794
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS5 pAb (ATL-HPA005661)
Datasheet Anti ADAMTS5 pAb (ATL-HPA005661) Datasheet (External Link)
Vendor Page Anti ADAMTS5 pAb (ATL-HPA005661) at Atlas Antibodies

Documents & Links for Anti ADAMTS5 pAb (ATL-HPA005661)
Datasheet Anti ADAMTS5 pAb (ATL-HPA005661) Datasheet (External Link)
Vendor Page Anti ADAMTS5 pAb (ATL-HPA005661)