Anti ADAMTS4 pAb (ATL-HPA068374)

Atlas Antibodies

Catalog No.:
ATL-HPA068374-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 4
Gene Name: ADAMTS4
Alternative Gene Name: ADAMTS-2, ADMP-1, KIAA0688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 93%, ENSRNOG00000003538: 92%
Entrez Gene ID: 9507
Uniprot ID: O75173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP
Gene Sequence ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP
Gene ID - Mouse ENSMUSG00000006403
Gene ID - Rat ENSRNOG00000003538
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS4 pAb (ATL-HPA068374)
Datasheet Anti ADAMTS4 pAb (ATL-HPA068374) Datasheet (External Link)
Vendor Page Anti ADAMTS4 pAb (ATL-HPA068374) at Atlas Antibodies

Documents & Links for Anti ADAMTS4 pAb (ATL-HPA068374)
Datasheet Anti ADAMTS4 pAb (ATL-HPA068374) Datasheet (External Link)
Vendor Page Anti ADAMTS4 pAb (ATL-HPA068374)