Anti ADAMTS3 pAb (ATL-HPA021369)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021369-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ADAMTS3
Alternative Gene Name: ADAMTS-4, KIAA0366
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043635: 82%, ENSRNOG00000027463: 84%
Entrez Gene ID: 9508
Uniprot ID: O15072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL |
| Gene Sequence | QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL |
| Gene ID - Mouse | ENSMUSG00000043635 |
| Gene ID - Rat | ENSRNOG00000027463 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADAMTS3 pAb (ATL-HPA021369) | |
| Datasheet | Anti ADAMTS3 pAb (ATL-HPA021369) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS3 pAb (ATL-HPA021369) at Atlas Antibodies |
| Documents & Links for Anti ADAMTS3 pAb (ATL-HPA021369) | |
| Datasheet | Anti ADAMTS3 pAb (ATL-HPA021369) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS3 pAb (ATL-HPA021369) |