Anti ADAMTS3 pAb (ATL-HPA021368)

Atlas Antibodies

Catalog No.:
ATL-HPA021368-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 3
Gene Name: ADAMTS3
Alternative Gene Name: ADAMTS-4, KIAA0366
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043635: 48%, ENSRNOG00000021420: 30%
Entrez Gene ID: 9508
Uniprot ID: O15072
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIID
Gene Sequence KPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIID
Gene ID - Mouse ENSMUSG00000043635
Gene ID - Rat ENSRNOG00000021420
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS3 pAb (ATL-HPA021368)
Datasheet Anti ADAMTS3 pAb (ATL-HPA021368) Datasheet (External Link)
Vendor Page Anti ADAMTS3 pAb (ATL-HPA021368) at Atlas Antibodies

Documents & Links for Anti ADAMTS3 pAb (ATL-HPA021368)
Datasheet Anti ADAMTS3 pAb (ATL-HPA021368) Datasheet (External Link)
Vendor Page Anti ADAMTS3 pAb (ATL-HPA021368)