Anti ADAMTS20 pAb (ATL-HPA027609)

Atlas Antibodies

Catalog No.:
ATL-HPA027609-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 20
Gene Name: ADAMTS20
Alternative Gene Name: GON-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022449: 48%, ENSRNOG00000033397: 45%
Entrez Gene ID: 80070
Uniprot ID: P59510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STRPCSQRRCWSQDCVQHKGMERGRLNCSTSCERKDSHQRMECTDNQIRQVNEIVYNSSTISLTSKNCRNPPCNYIVVTADSSQCANN
Gene Sequence STRPCSQRRCWSQDCVQHKGMERGRLNCSTSCERKDSHQRMECTDNQIRQVNEIVYNSSTISLTSKNCRNPPCNYIVVTADSSQCANN
Gene ID - Mouse ENSMUSG00000022449
Gene ID - Rat ENSRNOG00000033397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS20 pAb (ATL-HPA027609)
Datasheet Anti ADAMTS20 pAb (ATL-HPA027609) Datasheet (External Link)
Vendor Page Anti ADAMTS20 pAb (ATL-HPA027609) at Atlas Antibodies

Documents & Links for Anti ADAMTS20 pAb (ATL-HPA027609)
Datasheet Anti ADAMTS20 pAb (ATL-HPA027609) Datasheet (External Link)
Vendor Page Anti ADAMTS20 pAb (ATL-HPA027609)