Anti ADAMTS18 pAb (ATL-HPA044326)

Atlas Antibodies

Catalog No.:
ATL-HPA044326-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 18
Gene Name: ADAMTS18
Alternative Gene Name: ADAMTS21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053399: 84%, ENSRNOG00000050326: 84%
Entrez Gene ID: 170692
Uniprot ID: Q8TE60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST
Gene Sequence VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST
Gene ID - Mouse ENSMUSG00000053399
Gene ID - Rat ENSRNOG00000050326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAMTS18 pAb (ATL-HPA044326)
Datasheet Anti ADAMTS18 pAb (ATL-HPA044326) Datasheet (External Link)
Vendor Page Anti ADAMTS18 pAb (ATL-HPA044326) at Atlas Antibodies

Documents & Links for Anti ADAMTS18 pAb (ATL-HPA044326)
Datasheet Anti ADAMTS18 pAb (ATL-HPA044326) Datasheet (External Link)
Vendor Page Anti ADAMTS18 pAb (ATL-HPA044326)