Anti ADAMTS18 pAb (ATL-HPA044326)

Atlas Antibodies

SKU: ATL-HPA044326-25

• 

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 18
Gene Name: ADAMTS18
Alternative Gene Name: ADAMTS21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053399: 84%, ENSRNOG00000050326: 84%
Entrez Gene ID: 170692
Uniprot ID: Q8TE60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST
• Gene Sequence: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST
• Gene ID - Mouse: ENSMUSG00000053399
• Gene ID - Rat: ENSRNOG00000050326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.