Anti ADAMTS16 pAb (ATL-HPA067668)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067668-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADAMTS16
Alternative Gene Name: ADAMTS16s
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049538: 63%, ENSRNOG00000016812: 61%
Entrez Gene ID: 170690
Uniprot ID: Q8TE57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS |
Gene Sequence | GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS |
Gene ID - Mouse | ENSMUSG00000049538 |
Gene ID - Rat | ENSRNOG00000016812 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAMTS16 pAb (ATL-HPA067668) | |
Datasheet | Anti ADAMTS16 pAb (ATL-HPA067668) Datasheet (External Link) |
Vendor Page | Anti ADAMTS16 pAb (ATL-HPA067668) at Atlas Antibodies |
Documents & Links for Anti ADAMTS16 pAb (ATL-HPA067668) | |
Datasheet | Anti ADAMTS16 pAb (ATL-HPA067668) Datasheet (External Link) |
Vendor Page | Anti ADAMTS16 pAb (ATL-HPA067668) |