Anti ADAMTS13 pAb (ATL-HPA042844)

Atlas Antibodies

SKU:
ATL-HPA042844-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 13
Gene Name: ADAMTS13
Alternative Gene Name: C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900, TTP, vWF-CP, VWFCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014852: 80%, ENSRNOG00000005780: 79%
Entrez Gene ID: 11093
Uniprot ID: Q76LX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV
Gene Sequence AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV
Gene ID - Mouse ENSMUSG00000014852
Gene ID - Rat ENSRNOG00000005780
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADAMTS13 pAb (ATL-HPA042844)
Datasheet Anti ADAMTS13 pAb (ATL-HPA042844) Datasheet (External Link)
Vendor Page Anti ADAMTS13 pAb (ATL-HPA042844) at Atlas Antibodies

Documents & Links for Anti ADAMTS13 pAb (ATL-HPA042844)
Datasheet Anti ADAMTS13 pAb (ATL-HPA042844) Datasheet (External Link)
Vendor Page Anti ADAMTS13 pAb (ATL-HPA042844)