Anti ADAM8 pAb (ATL-HPA064637)

Atlas Antibodies

SKU:
ATL-HPA064637-25
  • Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase domain 8
Gene Name: ADAM8
Alternative Gene Name: CD156, CD156a, MS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025473: 75%, ENSRNOG00000017897: 70%
Entrez Gene ID: 101
Uniprot ID: P78325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV
Gene Sequence QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV
Gene ID - Mouse ENSMUSG00000025473
Gene ID - Rat ENSRNOG00000017897
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADAM8 pAb (ATL-HPA064637)
Datasheet Anti ADAM8 pAb (ATL-HPA064637) Datasheet (External Link)
Vendor Page Anti ADAM8 pAb (ATL-HPA064637) at Atlas Antibodies

Documents & Links for Anti ADAM8 pAb (ATL-HPA064637)
Datasheet Anti ADAM8 pAb (ATL-HPA064637) Datasheet (External Link)
Vendor Page Anti ADAM8 pAb (ATL-HPA064637)