Anti ADAM8 pAb (ATL-HPA064637)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064637-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ADAM8
Alternative Gene Name: CD156, CD156a, MS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025473: 75%, ENSRNOG00000017897: 70%
Entrez Gene ID: 101
Uniprot ID: P78325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV |
Gene Sequence | QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV |
Gene ID - Mouse | ENSMUSG00000025473 |
Gene ID - Rat | ENSRNOG00000017897 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAM8 pAb (ATL-HPA064637) | |
Datasheet | Anti ADAM8 pAb (ATL-HPA064637) Datasheet (External Link) |
Vendor Page | Anti ADAM8 pAb (ATL-HPA064637) at Atlas Antibodies |
Documents & Links for Anti ADAM8 pAb (ATL-HPA064637) | |
Datasheet | Anti ADAM8 pAb (ATL-HPA064637) Datasheet (External Link) |
Vendor Page | Anti ADAM8 pAb (ATL-HPA064637) |