Anti ADAM17 pAb (ATL-HPA051575)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051575-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ADAM17
Alternative Gene Name: CD156B, cSVP, TACE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052593: 97%, ENSRNOG00000060694: 96%
Entrez Gene ID: 6868
Uniprot ID: P78536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE |
Gene Sequence | KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE |
Gene ID - Mouse | ENSMUSG00000052593 |
Gene ID - Rat | ENSRNOG00000060694 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAM17 pAb (ATL-HPA051575) | |
Datasheet | Anti ADAM17 pAb (ATL-HPA051575) Datasheet (External Link) |
Vendor Page | Anti ADAM17 pAb (ATL-HPA051575) at Atlas Antibodies |
Documents & Links for Anti ADAM17 pAb (ATL-HPA051575) | |
Datasheet | Anti ADAM17 pAb (ATL-HPA051575) Datasheet (External Link) |
Vendor Page | Anti ADAM17 pAb (ATL-HPA051575) |
Citations for Anti ADAM17 pAb (ATL-HPA051575) – 1 Found |
He, Jiayue; Liu, Shuguang; Tan, Qi; Liu, Zhiying; Fu, Jiewen; Li, Ting; Wei, Chunli; Liu, Xiaoyan; Mei, Zhiqiang; Cheng, Jingliang; Wang, Kai; Fu, Junjiang. Antiviral Potential of Small Molecules Cordycepin, Thymoquinone, and N6, N6-Dimethyladenosine Targeting SARS-CoV-2 Entry Protein ADAM17. Molecules (Basel, Switzerland). 2022;27(24) PubMed |