Anti ADAM17 pAb (ATL-HPA010738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010738-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ADAM17
Alternative Gene Name: CD156B, cSVP, TACE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052593: 85%, ENSRNOG00000060694: 86%
Entrez Gene ID: 6868
Uniprot ID: P78536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR |
Gene Sequence | SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR |
Gene ID - Mouse | ENSMUSG00000052593 |
Gene ID - Rat | ENSRNOG00000060694 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAM17 pAb (ATL-HPA010738) | |
Datasheet | Anti ADAM17 pAb (ATL-HPA010738) Datasheet (External Link) |
Vendor Page | Anti ADAM17 pAb (ATL-HPA010738) at Atlas Antibodies |
Documents & Links for Anti ADAM17 pAb (ATL-HPA010738) | |
Datasheet | Anti ADAM17 pAb (ATL-HPA010738) Datasheet (External Link) |
Vendor Page | Anti ADAM17 pAb (ATL-HPA010738) |
Citations for Anti ADAM17 pAb (ATL-HPA010738) – 2 Found |
Zhang, Tie-cheng; Zhu, Wei-guo; Huang, Ming-de; Fan, Rui-hua; Chen, Xiao-fei. Prognostic value of ADAM17 in human gastric cancer. Medical Oncology (Northwood, London, England). 2012;29(4):2684-90. PubMed |
Fabbi, Marina; Costa, Delfina; Russo, Daniela; Arenare, Laura; Gaggero, Gabriele; Signoriello, Simona; Scambia, Giovanni; Pisano, Carmela; Colombo, Nicoletta; Losito, Nunzia Simona; Filaci, Gilberto; Spina, Anna; Califano, Daniela; Scognamiglio, Giosuè; Gadducci, Angiolo; Mezzanzanica, Delia; Bagnoli, Marina; Ferrini, Silvano; Canzonieri, Vincenzo; Chiodini, Paolo; Perrone, Francesco; Pignata, Sandro. Analysis of A Disintegrin and Metalloprotease 17 (ADAM17) Expression as a Prognostic Marker in Ovarian Cancer Patients Undergoing First-Line Treatment Plus Bevacizumab. Diagnostics (Basel, Switzerland). 2022;12(9) PubMed |