Anti ADAM17 pAb (ATL-HPA010738)

Atlas Antibodies

SKU: ATL-HPA010738-25

• 
• 

Protein Description: ADAM metallopeptidase domain 17
Gene Name: ADAM17
Alternative Gene Name: CD156B, cSVP, TACE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052593: 85%, ENSRNOG00000060694: 86%
Entrez Gene ID: 6868
Uniprot ID: P78536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
• Gene Sequence: SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
• Gene ID - Mouse: ENSMUSG00000052593
• Gene ID - Rat: ENSRNOG00000060694
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAM17 pAb (ATL-HPA010738) – 2 Found

Zhang, Tie-cheng; Zhu, Wei-guo; Huang, Ming-de; Fan, Rui-hua; Chen, Xiao-fei. Prognostic value of ADAM17 in human gastric cancer. Medical Oncology (Northwood, London, England). 2012;29(4):2684-90. 

Fabbi, Marina; Costa, Delfina; Russo, Daniela; Arenare, Laura; Gaggero, Gabriele; Signoriello, Simona; Scambia, Giovanni; Pisano, Carmela; Colombo, Nicoletta; Losito, Nunzia Simona; Filaci, Gilberto; Spina, Anna; Califano, Daniela; Scognamiglio, Giosuè; Gadducci, Angiolo; Mezzanzanica, Delia; Bagnoli, Marina; Ferrini, Silvano; Canzonieri, Vincenzo; Chiodini, Paolo; Perrone, Francesco; Pignata, Sandro. Analysis of A Disintegrin and Metalloprotease 17 (ADAM17) Expression as a Prognostic Marker in Ovarian Cancer Patients Undergoing First-Line Treatment Plus Bevacizumab. Diagnostics (Basel, Switzerland). 2022;12(9)