Anti ADAM15 pAb (ATL-HPA011633)

Atlas Antibodies

Catalog No.:
ATL-HPA011633-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase domain 15
Gene Name: ADAM15
Alternative Gene Name: MDC15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028041: 82%, ENSRNOG00000020590: 84%
Entrez Gene ID: 8751
Uniprot ID: Q13444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKC
Gene Sequence CQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKC
Gene ID - Mouse ENSMUSG00000028041
Gene ID - Rat ENSRNOG00000020590
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAM15 pAb (ATL-HPA011633)
Datasheet Anti ADAM15 pAb (ATL-HPA011633) Datasheet (External Link)
Vendor Page Anti ADAM15 pAb (ATL-HPA011633) at Atlas Antibodies

Documents & Links for Anti ADAM15 pAb (ATL-HPA011633)
Datasheet Anti ADAM15 pAb (ATL-HPA011633) Datasheet (External Link)
Vendor Page Anti ADAM15 pAb (ATL-HPA011633)
Citations for Anti ADAM15 pAb (ATL-HPA011633) – 2 Found
Yang, C Y; Chanalaris, A; Bonelli, S; McClurg, O; Hiles, G Lorenzatti; Cates, A L; Zarebska, J Miotla; Vincent, T L; Day, M L; Müller, S A; Lichtenthaler, S F; Nagase, H; Scilabra, S D; Troeberg, L. Interleukin 13 (IL-13)-regulated expression of the chondroprotective metalloproteinase ADAM15 is reduced in aging cartilage. Osteoarthritis And Cartilage Open. 2020;2(4):100128.  PubMed
Carreca, Anna Paola; Pravatà, Veronica Maria; D'Apolito, Danilo; Bonelli, Simone; Calligaris, Matteo; Monaca, Elisa; Müller, Stephan A; Lichtenthaler, Stefan F; Scilabra, Simone Dario. Quantitative Proteomics Reveals Changes Induced by TIMP-3 on Cell Membrane Composition and Novel Metalloprotease Substrates. International Journal Of Molecular Sciences. 2021;22(5)  PubMed