Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030867-25

• 
• 

Protein Description: ADAM metallopeptidase domain 12
Gene Name: ADAM12
Alternative Gene Name: MCMPMltna, MLTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054555: 61%, ENSRNOG00000018384: 61%
Entrez Gene ID: 8038
Uniprot ID: O43184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
• Gene Sequence: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
• Gene ID - Mouse: ENSMUSG00000054555
• Gene ID - Rat: ENSRNOG00000018384
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) – 2 Found

Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. 

Naciri, Ikrame; Laisné, Marthe; Ferry, Laure; Bourmaud, Morgane; Gupta, Nikhil; Di Carlo, Selene; Huna, Anda; Martin, Nadine; Peduto, Lucie; Bernard, David; Kirsh, Olivier; Defossez, Pierre-Antoine. Genetic screens reveal mechanisms for the transcriptional regulation of tissue-specific genes in normal cells and tumors. Nucleic Acids Research. 2019;47(7):3407-3421.