Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030867-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase domain 12
Gene Name: ADAM12
Alternative Gene Name: MCMPMltna, MLTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054555: 61%, ENSRNOG00000018384: 61%
Entrez Gene ID: 8038
Uniprot ID: O43184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
Gene Sequence LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
Gene ID - Mouse ENSMUSG00000054555
Gene ID - Rat ENSRNOG00000018384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation)
Datasheet Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation)
Datasheet Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation)
Citations for Anti ADAM12 pAb (ATL-HPA030867 w/enhanced validation) – 2 Found
Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54.  PubMed
Naciri, Ikrame; Laisné, Marthe; Ferry, Laure; Bourmaud, Morgane; Gupta, Nikhil; Di Carlo, Selene; Huna, Anda; Martin, Nadine; Peduto, Lucie; Bernard, David; Kirsh, Olivier; Defossez, Pierre-Antoine. Genetic screens reveal mechanisms for the transcriptional regulation of tissue-specific genes in normal cells and tumors. Nucleic Acids Research. 2019;47(7):3407-3421.  PubMed