Anti ADAL pAb (ATL-HPA048175)

Atlas Antibodies

Catalog No.:
ATL-HPA048175-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adenosine deaminase-like
Gene Name: ADAL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027259: 87%, ENSRNOG00000030157: 26%
Entrez Gene ID: 161823
Uniprot ID: Q6DHV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAE
Gene Sequence DILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAE
Gene ID - Mouse ENSMUSG00000027259
Gene ID - Rat ENSRNOG00000030157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ADAL pAb (ATL-HPA048175)
Datasheet Anti ADAL pAb (ATL-HPA048175) Datasheet (External Link)
Vendor Page Anti ADAL pAb (ATL-HPA048175) at Atlas Antibodies

Documents & Links for Anti ADAL pAb (ATL-HPA048175)
Datasheet Anti ADAL pAb (ATL-HPA048175) Datasheet (External Link)
Vendor Page Anti ADAL pAb (ATL-HPA048175)