Anti ADA pAb (ATL-HPA023884 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023884-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/85451/155840/atl-hpa023884_anti-ada-pab-atl-hpa023884-wenhanced-validation_37473__97185.1681106482.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ADA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017697: 83%, ENSRNOG00000010265: 88%
Entrez Gene ID: 100
Uniprot ID: P00813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC |
| Gene Sequence | QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC |
| Gene ID - Mouse | ENSMUSG00000017697 |
| Gene ID - Rat | ENSRNOG00000010265 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADA pAb (ATL-HPA023884 w/enhanced validation) | |
| Datasheet | Anti ADA pAb (ATL-HPA023884 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADA pAb (ATL-HPA023884 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ADA pAb (ATL-HPA023884 w/enhanced validation) | |
| Datasheet | Anti ADA pAb (ATL-HPA023884 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADA pAb (ATL-HPA023884 w/enhanced validation) |
| Citations for Anti ADA pAb (ATL-HPA023884 w/enhanced validation) – 1 Found |
| Huang, Jun; He, Yujiao; Chen, Mingna; Du, Juan; Li, Guoliang; Li, Shuyu; Liu, Weiping; Long, Xiaoyan. Adenosine deaminase and adenosine kinase expression in human glioma and their correlation with glioma‑associated epilepsy. Molecular Medicine Reports. 2015;12(5):6509-16. PubMed |