Anti ADA pAb (ATL-HPA023884 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023884-25

• 
• 

Protein Description: adenosine deaminase
Gene Name: ADA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017697: 83%, ENSRNOG00000010265: 88%
Entrez Gene ID: 100
Uniprot ID: P00813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC
• Gene Sequence: QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC
• Gene ID - Mouse: ENSMUSG00000017697
• Gene ID - Rat: ENSRNOG00000010265
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADA pAb (ATL-HPA023884 w/enhanced validation) – 1 Found

Huang, Jun; He, Yujiao; Chen, Mingna; Du, Juan; Li, Guoliang; Li, Shuyu; Liu, Weiping; Long, Xiaoyan. Adenosine deaminase and adenosine kinase expression in human glioma and their correlation with glioma‑associated epilepsy. Molecular Medicine Reports. 2015;12(5):6509-16.